PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang10g04870.1
Common NameLR48_Vigan01g002100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NAC
Protein Properties Length: 235aa    MW: 26466.8 Da    PI: 8.5446
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang10g04870.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM152.32.3e-47141411128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrF+Ptdeelv +yLk kv + +l++ ++i+e++++k++PwdLp ++  + +e yfFs+++ ky++g+r nr+tk gyWkatg+dk++ s+
  Vang10g04870.1  14 LPPGFRFQPTDEELVFQYLKCKVFSYPLPA-SIIPEINVCKHDPWDLPGNC--DPQERYFFSPKEAKYRNGNRMNRTTKCGYWKATGSDKRISSS 105
                     79****************************.89***************544..67899***********************************98 PP

             NAM  96 ...kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +  vg++ktL+fy+g++pkg++tdWv+heyrl
  Vang10g04870.1 106 snaCNGIVGIRKTLIFYEGKSPKGSRTDWVLHEYRL 141
                     5555556***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.5E-5510170IPR003441NAC domain
PROSITE profilePS5100553.08514170IPR003441NAC domain
PfamPF023651.8E-2415141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0010089Biological Processxylem development
GO:0010150Biological Processleaf senescence
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MEKLNFVKNG VSKLPPGFRF QPTDEELVFQ YLKCKVFSYP LPASIIPEIN VCKHDPWDLP  60
GNCDPQERYF FSPKEAKYRN GNRMNRTTKC GYWKATGSDK RISSSSNACN GIVGIRKTLI  120
FYEGKSPKGS RTDWVLHEYR LANAETAACN SSHNYVNEIG DWVLCRLSMK KRSIESGVDE  180
KQRVHGGPRL MFDFMMLGKT DSSTSSSCSS SNNIMEVSSN VSDHEETSGG YTYF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-471417517170NO APICAL MERISTEM PROTEIN
1ut4_B3e-471417517170NO APICAL MERISTEM PROTEIN
1ut7_A3e-471417517170NO APICAL MERISTEM PROTEIN
1ut7_B3e-471417517170NO APICAL MERISTEM PROTEIN
4dul_A3e-471417517170NAC domain-containing protein 19
4dul_B3e-471417517170NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00507DAPTransfer from AT5G13180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150341e-154AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014508020.11e-177PREDICTED: NAC domain-containing protein 83-like
SwissprotQ9FY931e-71NAC83_ARATH; NAC domain-containing protein 83
TrEMBLA0A0L9TJ771e-177A0A0L9TJ77_PHAAN; Uncharacterized protein
TrEMBLA0A0S3QXU61e-177A0A0S3QXU6_PHAAN; Uncharacterized protein
STRINGGLYMA05G38380.11e-142(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70434139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.17e-72NAC domain containing protein 83
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]